BOOST YOUR SUPERIORITY BOOST is a turnaround stage private equity firm specializing in late-stage mature companies, toxic assets, startups in insolvency, and cutting-edge seed projects. Portfolio NAV is more than $460 bln (31.12.2020, RAS, forecast). The BOOST's business model is based on the core competence to manage company value. BOOST possesses many years of unique experience to ensure the ability to maximize the value of the portfolio assets. BOOST renders assets management & GP services, corporate turnaround advisory, business transformation, interim, execution of complicated M&A cross-border transactions, management of super-large projects. CEO, owner & founder Raevskaya-Repnina, Oxford Business Alumni, a fellow of the St Hugh’s College, Said Business School. www.boostcmg.com #boost #boostyoursuperiority #boostprivateequity #privateequity #boost #boostyoursuperiority #investmentmagic #witchinglist #witchme #crueltyfreeinvestments #raevskayarepnina #raevskayarepninaannamariaserafima #annamariaserafimaraevskayarepnina #assetsmanagement #corporateturnaround #assets distress #interim #fundgp #businessrecovery #venturefund #latestageinvestments #seed #rounda #investments #privateequity #assetdistress #assetsmanagement #crossborderma #fundgp #portfoliomanagement #corporateturnaround #noncoreassets #reit #investments #jpop #jazz #sdg #sustainability #impact #responsibleinvesting #socialinvesting #startedinoxford #oxfordsbs #sthughscollege #oxfordbusinessalumni #saidbusinessschool #universityofoxford #russia #global #moscow #uk #oxford #portsmouth #london #women #womenfounders #раевскаярепнина  #аннамариясерафимараевскаярепнина #раевскаярепнинааннамариясерафима

ELEPHANT

Welcome to the Elephant's page of the BOOST private equity firm!

As you may observe, BOOST delivers returns that are much higher than the market comparables. We outperform the market and all top-tier high performers from our peers. That's why we often get asked how we do that and what tools we use to manage the value of portfolio companies, how to evaluate businesses, how to manage large-scale cross-border projects, why we don't use debt, how to run legally compliant private equity business that delivers profit, and how to deal with all this toxic stuff which we have on our balance. We attest that we use black color for our design, however, not black magic. And we do sustainable, compliant, white, transparent business. In response, we would like to clean up your doubts by creating this handy list shared with you. These are all things that we use daily and love. And they are explaining how we make money and generate our high returns. This page is a work in progress. We will add materials and update them regularly. You are welcome to follow us on social media to watch our trendy posts, our news, and more information that we will share.

  • BOOST is a turnaround stage private equity firm specializing in late-stage mature companies, toxic a
  • #raevskayarepnina #раевскаярепнина #boost #hasheight #2R #2Rlawfirm #irregulaw #boostyoursuperiority
  • #raevskayarepnina #раевскаярепнина #boost #hasheight #2R #2Rlawfirm #irregulaw #boostyoursuperiority
  • #raevskayarepnina #раевскаярепнина #boost #hasheight #2R #2Rlawfirm #irregulaw #boostyoursuperiority
  • #raevskayarepnina #раевскаярепнина #boost #hasheight #2R #2Rlawfirm #irregulaw #boostyoursuperiority
  • #raevskayarepnina #раевскаярепнина #boost #hasheight #2R #2Rlawfirm #irregulaw #boostyoursuperiority
  • #raevskayarepnina #раевскаярепнина #boost #hasheight #2R #2Rlawfirm #irregulaw #boostyoursuperiority
  • #raevskayarepnina #раевскаярепнина #boost #hasheight #2R #2Rlawfirm #irregulaw #boostyoursuperiority
 

Essential things to run your portfolio

Information

In the private equity business, there is always much data that you need to have for assets management and deals making. It concerns deals valuation, fund management, business organization, statistics, and much other stuff. We share the sources of information, that we used to utilize for our daily operations, valuation, strategic development. Also, we give you some links that may be useful for you. These are the sources of information that we use in 99% of the cases. We don't read secondary analytical reports and don't buy any marketing or IB reports. We always do our data collection and analysis. Why? Below is the answer.

1. Conflict of expertise.

Analytical reports are prepared by analysts, not by private equity managers. The mindset, background, experience, and logic of a portfolio manager at the PE firm are very different from an analyst. Data that are important for you are useless for analysts. Analysts can reshape the focus of the analysis. That makes the data and the conclusion opposite to the real situation. And opposite to the right decision as well.

2. Conflict of interest.

Banks prepare their analytical reports considering in the researches those companies who are the clients of these reports-makers. The conclusion is simple - the recommendation buy, hold or sell (which is issued to the market and commented on public media) is made based on an engagement letter signed between the bank (or expecting to sign that), prepared the report, and the client. The same we can say about reports of consulting companies and rating agencies. We solve this problem simpler. We don't read them.

3. Low data reliability.

Internet is the largest source of data and information. Hence, it was never a trustful data provider. You never know the reference source of the data for the prepared analytical report bought or downloaded. However, in the vast majority of the cases, these are the data from open internet sources and sometimes previously gathered by somebody else. These "reports" study the internet, not the market. You don't want to make your decision on well-blended trash, don't you?

PE industrial statistics, peers, benchmarks

BOOST possesses industrial insights which we are going to publish and disclose as soon as our сomprehensive knowledge base transformed into clear concise communication and well-designed form. However, we are not the whole market, and we are not the representative sample. We share the following "must-have" sources of raw data that you may find quite helpful for your decision-making process. They are necessary if you are working in PE or VC industries.

PitchBook is a financial data and software company with offices in London, New York, San Francisco, and Seattle. Serving clients in 19 languages and provides thousands of global business professionals with comprehensive data on the private and public markets, helping discover and execute opportunities with confidence. PitchBook covers the vast majority of PE funds that deserving have the name PE or VC fund. If your company is not on the list - you are not a PE firm. Or maybe you are a top-secret fund. Subscribe and provide Pitchbook with your data. 

EMPEA is the global industry association for private capital in emerging markets. An independent, non-profit organization, the association brings together 300+ firms—including institutional investors, fund managers, and industry advisors—who manage more than USD5 trillion in assets across 130 countries. EMPEA supports its members globally through authoritative research and intelligence, investor meetings, education, and advocacy. They publish free data and reports. The advanced statistics are available only for members. Membership is rather expensive.

Investors rely on Crunchbase data to track portfolio companies and investment opportunities. Crunchbase is directly related to TechCrunch - internet media writing about startups and venture investments, especially in the IT and technology sector. If you have a tech startup, but TechCrunch didn't write about it - you don't have a tech startup. You can add into Crunchbase your company, yourself if you are a founder and fellow organizations that are interesting for you. There are free and premium versions.

TechCrunch reports on the business of technology, startups, venture capital funding, and Silicon Valley.

Market data: public securities, indexes, commodities

This expensive professional solution is vital for fundamental analysis, deals and business valuation, management decisions, and scenario modeling. Hence, there are some problems with data download for further utilization. Bloomberg is the essential data source for an investment modeling process - beta calculation, multiples, comparable benchmarks.

Simple, fast access to the high-level market data. Enough for the express decision-making process and covers 80% of daily PE management. We use them basically to understand the fair stock price and make an assumption about overpricing. There are all data essentials - EPS, current stock price, multiples, valuation, high-level financials, and quite detailed ownership structure.

Aswath Damodaran is a Professor of corporate finance and valuation at the Stern School of Business at New York University. On his website, you may find much helpful information for your calculations and financial modeling. Data include breakdowns by emerging/developed countries and by geography. We use these data as a redline to test/match our assumptions. There is much detailed, well-structured information about multiples, margins, TSR, ROE, beta, capital structure. Here you may find most of the initial assumptions that you need for your financial modeling at a basic level.

Stock Exchanges

We use data of stock exchanges to get a rough overview of stock movement trajectory during a definite period but first and foremost for the news explaining the concrete stock movement. So if you do not have Bloomberg, use stock exchange data but keep in mind that it may take a little bit more time to download all information necessary for you. Below are the links to the stock exchanges covering the majority of business activity.

Academic knowledge

The Private Equity Institute was founded in 2009 to provide a forum to promote research, education, and networking, in private equity. Oxford Saïd ran its first Private Equity elective in 2000 and introduced the Private Equity Forum in 2006. At the moment, SBS is the only educational center combining sound theoretical knowledge with scientific R&D in a very opaque private equity industry.

Tim Jenkinson is one of the leading authorities on private equity, IPOs, and institutional asset management. Tim is renowned for his ability to collect critical, previously inaccessible data by building strong links with institutional investors, regulators, and other players in the financial industry. His research is widely quoted and has been published in the top academic journals. Tim is Director of the Oxford Private Equity Institute and one of the founders of the Private Equity Research Consortium.

Ludovic Phallipou is a professor of financial economics at the University of Oxford, Saïd business school. He is the author of the bestseller "Private Equity Laid Bare," and professor of Financial Economics at Saïd Business School, University of Oxford. He specializes in private market investments focusing on fee tracking, interest alignment, and return benchmarking. Named as one of “The 40 Most Outstanding Business School Profs Under 40 in the World” in 2014, and as one of the 20 most influential individuals in private equity in Europe in 2016, Ludovic has strong links with senior practitioners in the industry, routinely speaks at practitioner conferences, and appears in the media internationally. 

PE industrial market makers

We don't read analytical reports. We are watching on the investment funds that have PE segments. We watch on these funds, but we do not copy/paste what they are doing. We take into consideration their activities.

VC industrial market makers

Global asset management

These funds are not private equity funds in their pure form. Hence, they manage a variety of different funds - PE, REIT, fixed-income funds. Also, they are investing abroad and can affect the public securities market.

Global economy and industrial statistics 

The best sources of information about the industry and the global economy are governmental organizations that gather the statistics and process this. For local data, visit governmental websites per country.

Organization

Follow this section and our blog to learn how PE organize themselves, types of PE/VC organizational structure, which competencies you need to maintain in-house, which competencies you can easily outsource, and many other aspects of fund organization.

Policies and procedures

Follow this section to get the templates of operational, legal documents, templates of financial models, scenario analysis, pitch decks, and others.

Disclosures

If you are running a PE/VC fund and looking for LPs or plan to follow market trends, register your company on Crunchbase and Pitchbook platforms.

Сайт с полностью русскоязычным контентом доступен на локализованной для России версии сайта.

Local website for your country coming soon!

 

Reading list

This is a list in progress. Follow us to see what's new here. Where to buy: Amazon, Waterstones.

The Alternative Oxford Private Equity Dictionary Paperback by Ludovic Phalippou

Private Equity Laid Bare by Ludovic Phalippou

 

Institutional Investors and Equity Markets: On mutual fund liquidity management, performance of private equity funds, and the value premium by Ludovic Phalippou 

 

Barbarians At The Gate: The Fall of RJR Nabisco by Bryan Burrough,  John Helyar

 

King of Capital: The Remarkable Rise, Fall, and Rise Again of Steve Schwarzman and Blackstone by David Carey , John E. Morris​

 

The Masters of Private Equity and Venture Capital: Management Lessons from the Pioneers of Private Investing   - Robert Finkel, David Greising​​

By Andrew Ross Sorkin Too Big to Fail: The Inside Story of How Wall Street and Washington Fought to Save the Financial System -- And Themselves (1st Edition) by Andrew Ross Sorkin  

Leveraged Buyouts: A Practical Guide to Investment Banking and Private Equity + Website (Wiley Finance) by Paul Pignataro

Valuation: Measuring and Managing the Value of Companies (Wiley Finance) by McKinsey & Company Inc. (Author), Tim Koller, Marc Goedhart, David Wessels

Investment Valuation: Tools and Techniques for Determining the Value of any Asset, University Edition (Wiley Finance) by Aswath Damodaran 

Private Equity Funds: Formation and Operations Kindle Edition by Stephanie R. Breslow, Phyllis A. Schwartz

Private Equity: History, Governance and Operations (Wiley Finance) by Harry Cendrowski, James P. Martin, Louis W. Petro, Adam A. Wadecki

Private Equity: The Professional Investor's Handbook: 495 (Wiley Finance) by Kocis, Bachman IV, Long III 

Inside Private Equity: Thrills, spills and lessons by the author of Nothing Ventured, Nothing Gained by Bill Ferris 

Venture Capital 101 by Bill Snow (2015-05-29) by Bill Snow  (Author)

 

Private Equity Secrets Revealed: From the Coalface by Peter Cartier (Author)

 

The New Tycoons: Inside the Trillion Dollar Private Equity Industry That Owns Everything: 163 (Bloomberg) by Jason Kelly

From Zero to Sixty on Hedge Funds and Private Equity 3.0 Paperback – 21 Aug. 2015

by Jonathan Stanford Yu (Author)

Private Equity Operational Due Diligence: Tools to Evaluate Liquidity, Valuation, and Documentation + Website: 731 (Wiley Finance) by Jason A. Scharfman  

Private Equity: History, Governance, and Operations:738 (Wiley Finance) by Louis W. Petro (Author), James P. Martin, Harry Cendrowski, Adam A. Wadecki 

Emerging Markets: A Practical Approach: 134 (Wiley Finance) by Pereiro.

 

Blog

Our blog is dedicated to industrial insights into PE daily activities and to express our opinion on market trends meaningful for the global economy and private equity industry. 

 

Witch Me!

In this section, we share our "witching list" - videos and the other meaningful stuff that you must know if you work in Private Equity.

We witched and gathered all these videos to share with you our vision about the investment world and the stuff that matters in the private equity context. It's the diamond of our

"Guy's Elephant Section" helping you to deliver returns as we do. Watch this list from the beginning till the end, and your life will be changed forever. One rule: keep watching in the same sequence as videos placed. Don't miss videos and watch them in full. Otherwise, magic doesn't work. Through these videos, we are witching you to learn investment magic tricks by transferring to you how to see the world through our eyes. Watch this to create investment miracles and make people happy! Follow #boost #witchinglist #boostyoursuperiority #privateequity #investmentmagic #investmentmagiccrashcourse #witchme #holybitch #investmentwitch.

 

Downloads

This section is a work in progress. We are working on this now. You can download from this section our reports, insights, documentation templates, and other information as soon as we place it here. Be patient, and come back to check it out to find out more.

BOOST's backgrounds

Download them unconditionally free to boost your superiority. And we don't collect or save your personal data. These two phrases are our license agreement.

BOOST MOSCOW
+7 495 748 81 78
boost@boostcmg.com
10 Vozdvizhenka
125009 Moscow
Russian Federation

Telegram: @boostyoursuperiority

Whatsapp:+7 925 382 63 08

Terms of Use and Cookies Policy

BOOST is a turnaround stage private equity firm specializing in late-stage mature companies, toxic assets, startups in insolvency, and cutting-edge seed projects. www.boostcmg.com #boost #boostyoursuperiority #boostprivateequity #privateequity #boost#investmentmagic #witchinglist #witchme #crueltyfreeinvestments #raevskayarepnina #raevskayarepninaannamariaserafima #annamariaserafimaraevskayarepnina #assetsmanagement #corporateturnaround #assets distress #interim #fundgp #businessrecovery #venturefund #latestageinvestments #seed #rounda #investments #privateequity #assetdistress #assetsmanagement #crossborderma #fundgp #portfoliomanagement#noncoreassets #reit #investments#sdg #sustainability #impact #responsibleinvesting #socialinvesting #startedinoxford #oxfordsbs #sthughscollege #oxfordbusinessalumni #saidbusinessschool #universityofoxford #russia #moscow #uk #oxford #portsmouth #london #раевскаярепнина  #аннамариясерафимараевскаярепнина #раевскаярепнинааннамариясерафима
  • BOOST is a turnaround stage private equity firm specializing in late-stage mature companies, toxic a
  • #raevskayarepnina #раевскаярепнина #boost #hasheight #2R #2Rlawfirm #irregulaw #boostyoursuperiority
  • #raevskayarepnina #раевскаярепнина #boost #hasheight #2R #2Rlawfirm #irregulaw #boostyoursuperiority
  • #raevskayarepnina #раевскаярепнина #boost #hasheight #2R #2Rlawfirm #irregulaw #boostyoursuperiority
  • #raevskayarepnina #раевскаярепнина #boost #hasheight #2R #2Rlawfirm #irregulaw #boostyoursuperiority
  • #raevskayarepnina #раевскаярепнина #boost #hasheight #2R #2Rlawfirm #irregulaw #boostyoursuperiority
  • #raevskayarepnina #раевскаярепнина #boost #hasheight #2R #2Rlawfirm #irregulaw #boostyoursuperiority
  • #raevskayarepnina #раевскаярепнина #boost #hasheight #2R #2Rlawfirm #irregulaw #boostyoursuperiority
BOOST is a turnaround stage private equity firm specializing in late-stage mature companies, toxic assets, startups in insolvency, and cutting-edge seed projects. www.boostcmg.com #boost #boostyoursuperiority #boostprivateequity #privateequity #boost#investmentmagic #witchinglist #witchme #crueltyfreeinvestments #raevskayarepnina #raevskayarepninaannamariaserafima #annamariaserafimaraevskayarepnina #assetsmanagement #corporateturnaround #assets distress #interim #fundgp #businessrecovery #venturefund #latestageinvestments #seed #rounda #investments #privateequity #assetdistress #assetsmanagement #crossborderma #fundgp #portfoliomanagement#noncoreassets #reit #investments#sdg #sustainability #impact #responsibleinvesting #socialinvesting #startedinoxford #oxfordsbs #sthughscollege #oxfordbusinessalumni #saidbusinessschool #universityofoxford #russia #moscow #uk #oxford #portsmouth #london #раевскаярепнина  #аннамариясерафимараевскаярепнина #раевскаярепнинааннамариясерафима

3:12 He who overcomes, I will make him a pillar in the temple of My God, and he shall go out no more. I will write on him the name of My God and the name of the city of My God, the New Jerusalem, which comes down out of heaven from My God. And I will write on him My new name. 4:4 But He needed to go through Samaria. 5:16 Their quiver is like an open tomb; They are all mighty men. 6:19-21 Do not lay up for yourselves treasures on earth, where moth and rust destroy and where thieves break in and steal; but lay up for yourselves treasures in heaven, where neither moth nor rust destroys and where thieves do not break in and steal. For where your treasure is, there your heart will be also. 6:24 No one can serve two masters; for either he will hate the one and love the other, or else he will be loyal to the one and despise the other. You cannot serve God and mammon. 7:08 You go up to this feast. I am not yet going up to this feast, for My time has not yet fully come. 6:33 But seek first the kingdom of God and His righteousness, and all these things shall be added to you. 8:9 And a third of the living creatures in the sea died, and a third of the ships were destroyed. 8:12 Those by the wayside are the ones who hear; then the devil comes and takes away the word out of their hearts, lest they should believe and be saved. 12:3-4 And another sign appeared in heaven: behold, a great, fiery red dragon having seven heads and ten horns, and seven diadems on his heads. His tail drew a third of the stars of heaven and threw them to the earth. And the dragon stood before the woman who was ready to give birth, to devour her Child as soon as it was born. 14:12 Now on the first day of Unleavened Bread, when they killed the Passover lamb, His disciples said to Him, "Where do You want us to go and prepare, that You may eat the Passover?" 9:5 As long as I am in the world, I am the light of the world. 14:4 And where I go you know, and the way you know. 13:5 After that, He poured water into a basin and began to wash the discipleś feet, and to wipe them with the towel with which He was girded. 15:2-3 And the Pharisees and scribes complained, saying, «This Man receives sinners and eats with them. So He spoke this parable to them, saying." 16:1-4 Then I heard a loud voice from the temple saying to the seven angels, «Go and pour out the bowls of the wrath of God on the earth.» So the first went and poured out his bowl upon the earth, and a foul and loathsome sore came upon the men who had the mark of the beast and those who worshiped his image.Then the second angel poured out his bowl on the sea, and it became blood as of a dead man; and every living creature in the sea died.Then the third angel poured out his bowl on the rivers and springs of water, and they became blood. 16:3 And these things they will do to you because they have not known the Father nor Me. 18:3 Then Judas, having received a detachment of troops, and officers from the chief priests and Pharisees, came there with lanterns, torches, and weapons. 18:11 Put your sword into the sheath. Shall I not drink the cup which My Father has given Me? 18:11-12 And the merchants of the earth will weep and mourn over her, for no one buys their merchandise anymore: merchandise of gold and silver, precious stones and pearls, fine linen and purple, silk and scarlet, every kind of citron wood, every kind of object of ivory, every kind of object of most precious wood, bronze, iron, and marble. 19:2-3 And the soldiers twisted a crown of thorns and put it on His head, and they put on Him a purple robe. Then they said, «Hail, King of the Jews!» And they struck Him with their hands.19:11 You could have no power at all against Me unless it had been given you from above. Therefore the one who delivered Me to you has the greater sin. 22:9 Behold, a son shall be born to you, who shall be a man of rest; and I will give him rest from all his enemies all around. His name shall be Solomon, for I will give peace and quietness to Israel in his days. 27:11 But the nations that bring their necks under the yoke of the king of Babylon and serve him, I will let them remain in their own land,́ says the LORD, «and they shall till it and dwell in it. 23:9 Do not call anyone on earth your father; for One is your Father, He who is in heaven. 16:6-16:8 And I heard the angel of the waters saying: «You are righteous, O Lord, The One who is and who was and who is to be, Because You have judged these things.For they have shed the blood of saints and prophets, And You have given them blood to drink. For it is their just due.»And I heard another from the altar saying, «Even so, Lord God Almighty, true and righteous are Your judgments." 21:27 But there shall by no means enter it anything that defiles, or causes an abomination or a lie, but only those who are written in the Lamb́s Book of Life.

This site was designed with the
.com
website builder. Create your website today.
Start Now